PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G004100.1.p
Common NameLOC101785521, SETIT_000216mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 936aa    MW: 102492 Da    PI: 6.0713
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G004100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29588639152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Seita.5G004100.1.p 588 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 639
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.677578659IPR003035RWP-RK domain
PfamPF020423.3E-26591639IPR003035RWP-RK domain
SuperFamilySSF542777.85E-21831927No hitNo description
SMARTSM006661.0E-24841923IPR000270PB1 domain
PfamPF005641.8E-16841922IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.5E-25841922No hitNo description
PROSITE profilePS5174519.735841923IPR000270PB1 domain
CDDcd064072.48E-33842922No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 936 aa     Download sequence    Send to blast
MDLDPPTSGP GDACSVPADA WPFDSLTTSL LFSSVSASPP LPPLPANSSS WLTPPSPLWL  60
FEDRHLLPLE APQAPEAAVA AAVVEEVQRA RSGNSDTTSK RVEQINPKWQ FHLSLDGDGT  120
DNSSLFKERL TQALRYFKES TDQHLLVQVW APVKNGDRYV LTTSGQPFVL DHQSIGLIQY  180
RAVSMMYMFS VDGGNVGELG LPGRVYKLKV PEWTPNVQYY SSTEYPRLNH AISYNVHGTV  240
ALPVFDPSAQ SCIAVVELIM TSKKINYACE VDKVCKALEA VNLKSTEILD HPNVQICNEG  300
RQTALVEILE ILTVVCEEHK LPLAQTWVPC KYRSVLAHGG GLKKSCLSFD GSCMGEVCMS  360
TSDVAFHVID AHMWGFRDAC VEHHLQRGQG VSGNAFITRK PCFSKDIRKF CKIKYPLVHY  420
ARMFGLAGCL AICLQSSYTG HDDYILEFFL PPDCIDEDEQ NALLESIFTL MKQCLRSLKV  480
VGDADSSWVS LQLSNVLKIE NEELKTDAQF DNSDGSLNGS PEGDTHGGDH KFDNGNKKVS  540
DMPEGHLLAD DYSQDNGTSA SRPNGSGASD SSVLHKTNKP TERRRGKAEK TISLEVLQQY  600
FSGSLKNAAK SLGVCPTTMK RICRQHGISR WPSRKINKVN RSLSKLKQVI ESVQGSDAAF  660
NLTSITGPLP IPVGPSSDSH NVEKVTQSKV AEPSNLAVDG DRDSSLQRSL ENDGHFGIHM  720
AQQGFIDNNN DAQLEADKAS HSRSSSGEGS INSRTSEGSC QGSPANRTFV CKPIASTFAE  780
PQLNPEEFHK EPFQEPQLPL SRMLIEDSGS SKDLKNLFTP AADQPFLAPP SNLVSMKHSG  840
TVTIKASFKE DIVRFRFPCS GSVTVLKDEV AKRLRMDVGT FDIKYLDDDH EWVKLACNAD  900
LEECMEISRN SGSHVIRLLV SDITGHFGSS CGSSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967359.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3XE990.0K3XE99_SETIT; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein